PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011090094.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 190aa    MW: 20929.8 Da    PI: 5.6779
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011090094.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.32.3e-42301291100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C+++Cvlapyfp ++p kf  +h++FGasn++k+l++lpe +r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+++la
  XP_011090094.1  30 PCAACKILRRRCVEKCVLAPYFPPNDPLKFTTAHRVFGASNIIKFLQELPEPQRADAVSSMVYEANARLRDPVYGCAGAICQLQKQVSELQEQLA 124
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_011090094.1 125 KARAE 129
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.24729130IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4230127IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MEGSDTTITT VTSPSSSVSP PPQSHVVISP CAACKILRRR CVEKCVLAPY FPPNDPLKFT  60
TAHRVFGASN IIKFLQELPE PQRADAVSSM VYEANARLRD PVYGCAGAIC QLQKQVSELQ  120
EQLAKARAEL VNVQCQNANL MALICMEMAQ PNDHQSSLDA FGTSPRTYQS NANFLDENNT  180
GLVWEQLLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090094.11e-141PREDICTED: LOB domain-containing protein 1
SwissprotQ9LQR07e-70LBD1_ARATH; LOB domain-containing protein 1
TrEMBLD7SKT41e-89D7SKT4_VITVI; Putative uncharacterized protein
STRINGVIT_06s0004g03350.t014e-89(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-67LOB domain-containing protein 1